Sermorelin for Sale
Sermorelin is a synthetic analog of growth hormone-releasing hormone (GHRH), specifically the biologically active 1-29 amino acid fragment. This research peptide enables sophisticated investigations into somatotropic axis regulation and pituitary function.
When you buy Sermorelin from NextGen Peptide, you acquire a premium compound backed by complete analytical documentation. Every vial we sell Sermorelin with includes a third-party Certificate of Analysis (COA) verifying ≥98% purity through HPLC and mass spectrometry.
Researchers consistently order Sermorelin online from us because we eliminate sourcing uncertainty. Just verifiable, lab-tested peptide delivered with full transparency.
Sermorelin functions as a potent stimulator of endogenous growth hormone release through activation of GHRH receptors on pituitary somatotrophs. This mechanism makes it valuable for studying pulsatile GH secretion and feedback loop dynamics.
Why do leading laboratories purchase Sermorelin from NextGen Peptide? Each shipment includes endotoxin screening (<1 EU/mg) and complete chromatographic data.
Ready to advance your endocrine research? Order Sermorelin online today.
Why Purchase Sermorelin From NextGen Peptide?
-
≥98% purity verified by independent HPLC
-
Comprehensive COA included with every vial
-
Endotoxin tested – <1 EU/mg
-
24-hour dispatch on most orders
-
Secure checkout – credit card and crypto
Technical Specifications
| Parameter | Specification |
|---|---|
| Purity (HPLC) | ≥98% |
| Sequence | YADAIFTNSYRKVLGQLSARKLLQDIMSR-NH2 |
| Endotoxin | <1 EU/mg |
| Storage (lyophilized) | -20°C |
Research Applications
-
GHRH receptor binding studies
-
Pituitary somatotroph function research
-
Growth hormone pulse dynamics
-
Somatotropic axis investigations
Reconstitution: Use sterile bacteriostatic water. Gently swirl. Do not vortex.
How to Order Sermorelin Online
-
Select quantity (5mg, 10mg, or bulk)
-
Add to secure cart
-
Complete encrypted checkout
-
Receive COA via email
-
Receive tracking within 24 hours
FAQ
Is Sermorelin for human use? No. For research only.
Do you provide COAs? Yes, with every order.
Reviews
There are no reviews yet.